PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000306730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 333aa    MW: 37155.7 Da    PI: 8.8605
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000306730genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB139.49.8e-441811797
          NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                   m+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lw++++lGf+dy+epl++yl++yre+ege+
  MDP0000306730  1 MRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWTMSKLGFDDYIEPLTLYLHRYREMEGER 81
                   89*****************************************************************************97 PP

2trihelix81.61e-25243328186
       trihelix   1 rWtkqevlaLiearremeerlr.rgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                    rW++ ev+aLi+ r   e+++r +g  k+  Wee+s km+e g+ rs  +C+ekw+n+nk+++++  +++kr + + + cpyf++le
  MDP0000306730 243 RWPEAEVQALITQRAAFEHKFRvAGTPKGRIWEEISVKMHEMGYVRSGRKCREKWKNINKYFRRCMGSDNKR-PANAKLCPYFHELE 328
                    8*********************558999******************************************98.88889*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.2E-39192IPR009072Histone-fold
PfamPF008081.5E-18154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.19E-29185IPR009072Histone-fold
PRINTSPR006157.9E-161937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.9E-163856No hitNo description
PRINTSPR006157.9E-165775No hitNo description
PROSITE profilePS500906.899236301IPR017877Myb-like domain
CDDcd122035.80E-22242307No hitNo description
PfamPF138378.4E-19242328No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MRKILPPHAK ISDDAKETIQ ECVSEYISFI TGEANERCQR EQRKTITAED VLWTMSKLGF  60
DDYIEPLTLY LHRYREMEGE RGSSTTSLMR SESLAKGAGT SSGTSSSVID HHQYYGISMA  120
AVAAAFHHQH GHGFFGYMNP SDALVSNNNV NAASAAAASG SSTQLQGGXS AAMLLNYLGY  180
EIQVPQPSPA TAPERTPAPT AVPIPISVVP KYDHQRVEGN GKADNGMQRD LMLVSHSDAT  240
NRRWPEAEVQ ALITQRAAFE HKFRVAGTPK GRIWEEISVK MHEMGYVRSG RKCREKWKNI  300
NKYFRRCMGS DNKRPANAKL CPYFHELELL QKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-291761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-291761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-52nuclear factor Y, subunit B6